The 6 Peptide Skin Booster Serum (Renewal)

The 6 Peptide Skin Booster Serum (Renewal)

No ratings yet

Peptide-rich serum for skin elasticity & firmness

Main Benefit
Boost skin firmness & elasticity
Best For
Dry, Normal, Combination
Targets
anti-agingfine lineswrinkleselasticityfirmness

Sign in to track this product in your collection.

Have ItWant It
Add to routine:

About this product

COSRX *renew* The 6 Peptide Skin Booster Serum 150ml is a lightweight, multi-peptide hydrating serum delivering six types of peptides to improve skin firmness, elasticity, and moisture retention. The large 150ml size makes it ideal as a daily hydrating and anti-ageing treatment applied liberally after cleansing.

In a nutshell

Best for dry, normal, combination skin looking to address anti-aging, fine lines, wrinkles — with a focus on boost skin firmness & elasticity.

Skin Profile
The 6 Peptide Skin Booster Serum (Renewal)
COSRX
Main Benefits
Ingredient coverage
anti-aging
fine lines
wrinkles
elasticity
firmness
Ingredient Highlights
Key Actives
6 peptides complex · Niacinamide · Hyaluronic Acid
skinuity.comSkinuity
See your skin match %

Pro members get a personalised score on every product based on their skin profile.

Unlock with Pro — $4.99/mo

Quick Stats

Average Rating
Global Ratings0
CategorySerum & Ampoule
OriginSouth Korea

Key Ingredients

6 peptides complex
1/10
Niacinamide
pore minimising · brightening · barrier support · sebum control · anti-aging
1/10
Hyaluronic Acid
hydration · plumping · anti-aging · barrier support
1/10

Product Claims

Clean Beauty
🐰Cruelty-Free
🌸Fragrance-Free
🍃Alcohol-Free
Paraben-Free
Safety & Suitability
🤰Pregnancy SafeYes
🍄Fungal Acne SafeYes
🫧Non-ComedogenicYes
🌿Beginner FriendlyYes
🪸Reef SafeYes

Common Allergens

Based on confirmed product attributes. Always check the full ingredient list for personal allergens.

🌸Fragrance / ParfumFree
⚗️Alcohol (drying)Free
🧪ParabensFree
🍄Malassezia (Fungal Acne)Safe

Always check the full ingredient list if you have known allergies or sensitivities.

How to Use

  1. 1After toner, apply 3-4 pumps
  2. 2Pat gently into skin
  3. 3Follow with moisturizer
  4. 4Use AM/PM
🔬

Dermatologist Note

Lightweight; non-sticky; promotes collagen production

Based on published clinical literature and dermatological research.

Ingredient Analysis

3
Beneficial
0
Caution
0
Concern
Safe (1–3)Moderate (4–6)Concern (7–10)

Full Ingredient List (INCI)

3 ingredients

Listed in order of concentration (highest first)

6 peptides complex, Niacinamide, Hyaluronic Acid

💬

No reviews yet. Be the first to review this product!

Disclaimer: The information on this page is for informational purposes only and does not constitute medical or dermatological advice. Always do your own research, consult a qualified professional if you have concerns, and patch test new products before full application — especially if you have sensitive or reactive skin.